PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12235_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NAC
Protein Properties Length: 427aa    MW: 48061.1 Da    PI: 7.2153
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12235_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.51.9e-172775150
                                   NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                                          + pGfrF+Ptdeel+++yLkkk+eg++  + evi+e+di+++ePwdLp k
  cra_locus_12235_iso_1_len_1797_ver_3 27 MFPGFRFSPTDEELICYYLKKKLEGSDKCV-EVIPEIDICRHEPWDLPGK 75
                                          579************************777.99**************932 PP

2NAM39.51.7e-127411487128
                                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                           gk+ +v+s +++++g+k+tLvf++grapkg++t+W+mhey +
  cra_locus_12235_iso_1_len_1797_ver_3  74 GKNXNVKS-GSAVIGTKRTLVFHTGRAPKGQRTEWIMHEYCM 114
                                           56778888.9999***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100516.7341130IPR003441NAC domain
SuperFamilySSF1019411.96E-3421129IPR003441NAC domain
PfamPF023652.3E-1429113IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEQEEKKEVF VLSRKNMEIS IAEASSMFPG FRFSPTDEEL ICYYLKKKLE GSDKCVEVIP  60
EIDICRHEPW DLPGKNXNVK SGSAVIGTKR TLVFHTGRAP KGQRTEWIMH EYCMSGKAQD  120
LMVVCRLRKN IEFNLDENPR KGSAGQRHSS TLANDVAALS VVEQNGGKAG TLVADSCSKE  180
GSSSYNSHSV EQNDSWFDSV DKTTNEISPH GSSSCRQFQV LSFSLQLSCL LLIACLMHFQ  240
EEKPCMVXIL DNNRKRFFPS PVILINRECE IYTRAPXLVY PCQGFXSIFE MQGSDRNEED  300
WFADIMNDDI IKLDESSLTA NPHLLPTAPG EPQPKITSTE PSRVIAPAAL PFQGTANRRL  360
RLRRPKIELK NATPLTAYES GVVTLTRELV HSQDSQKSQK NLGMAIKHRV VLVLFVIILV  420
LLLYMKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068UGV57e-84A0A068UGV5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000150779e-73(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243